Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008484615.1 |
sequence |
PEP: >XP_008484615.1 MYSLAKFAASPAARSALISSARMTAMRPLSSSITSTSAFTQQTTPQTQQISILPAVRQFQTSAVSRDIDSAAKFIGAGAA |
Swiss-Prot | ATP synthase lipid-binding protein, mitochondrial |
KEGG | K02128 ATPeF0C, ATP5G, ATP9; F-type H+-transporting ATPase subunit c |
SUPERFAMILY | SSF81333 F1F0 ATP synthase subunit C superfamily |
Gene3D | G3DSA:1.20.20.10 |
Pfam | PF00137 ATP-synt_C; ATP synthase subunit C |
PRINTS | PR00124 |
ProSitePatterns | PS00605 ATPASE_C; ATP synthase c subunit signature. |
Hamap | MF_01396 |
You might be interested in these researchers

You might be interested in these references
