Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008483987.1 |
sequence |
PEP: >XP_008483987.1 MLLYRSLRGNSTPPPSDASSKEVDESQSADHGNNGTTREAEQLVVPDTREQAESTSYNPSDVDSSAVNSPGKSNMERGGR |
Swiss-Prot | Insulin-like growth factor 2 mRNA-binding protein 1 |
KEGG | K17391 IGF2BP1; insulin-like growth factor 2 mRNA-binding protein 1 |
SUPERFAMILY | SSF54791 Eukaryotic type KH-domain (KH-domain type I) superfamily |
Gene3D | G3DSA:3.30.1370.10 |
Pfam | PF00013 KH_1; KH domain |
SMART | SM00322 |
ProSiteProfiles | PS50084 KH_TYPE_1; Type-1 KH domain profile. |
You might be interested in these researchers

You might be interested in these references
