Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008483630.1 |
sequence |
PEP: >XP_008483630.1 MVKWHDRSFWHCSWVQEIDLEVYHPQLLKSYMKKMNNDFTEPPALEEPLDEEDKRMARLNRHNINDEELEKKYYRYGIKP |
Swiss-Prot | Chromodomain-helicase-DNA-binding protein Mi-2 homolog |
KEGG | K11643 CHD4, MI2B; chromodomain-helicase-DNA-binding protein 4 [EC:3.6.4.12] |
SUPERFAMILY | SSF54160 Chromo domain-like superfamily |
Gene3D | G3DSA:2.40.50.40 |
Pfam | PF00176 SNF2_N; SNF2 family N-terminal domain |
SMART | SM00487 |
ProSiteProfiles | PS50013 CHROMO_2; Chromo and chromo shadow domain profile. |
ProSitePatterns | PS00690 DEAH_ATP_HELICASE; DEAH-box subfamily ATP-dependent helicases signature. |
You might be interested in these researchers

You might be interested in these references
