Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008483484.1 |
sequence |
PEP: >XP_008483484.1 MSVSNSLACALTPVLTRKVATPVAVIRWVEELLQENLISMSVSNSLACALTPVLTRKVATPVAVINDCIDLDECRMMSYL |
Swiss-Prot | Latent-transforming growth factor beta-binding protein 4 |
KEGG | K17307 |
SUPERFAMILY | SSF57184 Growth factor receptor domain superfamily |
Gene3D | G3DSA:2.10.25.10 |
Pfam | PF07645 EGF_CA; Calcium-binding EGF domain |
SMART | SM00181 |
ProSiteProfiles | PS50026 EGF_3; EGF-like domain profile. |
ProSitePatterns | PS01186 EGF_2; EGF-like domain signature 2. |
You might be interested in these researchers

You might be interested in these references
