Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008483388.1 |
sequence |
PEP: >XP_008483388.1 GEIRRQALDHFNAEGSSDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGLQKQYYKWILTKNYSAL |
Swiss-Prot | Chromodomain-helicase-DNA-binding protein 1 |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF00176 SNF2_N; SNF2 family N-terminal domain |
SMART | SM00487 |
ProSiteProfiles | PS51194 HELICASE_CTER; Superfamilies 1 and 2 helicase C-terminal domain profile. |
ProSitePatterns | PS00690 DEAH_ATP_HELICASE; DEAH-box subfamily ATP-dependent helicases signature. |
You might be interested in these researchers

You might be interested in these references
