Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008481684.1 |
sequence |
PEP: >XP_008481684.1 MGDSKNNMLIKVENMVGTISVGCPLDLNQINSRVRYSEYNPGKFHGLIMKILNPRTTCLAFQSGKLLILGAKHEHDCKLA |
Swiss-Prot | TATA box-binding protein-like protein 2 |
KEGG | K03120 TBP, tbp; transcription initiation factor TFIID TATA-box-binding protein |
SUPERFAMILY | SSF55945 TATA-box binding protein-like superfamily |
Gene3D | G3DSA:3.30.310.10 |
Pfam | PF00352 TBP; Transcription factor TFIID (or TATA-binding protein, TBP) |
PRINTS | PR00686 |
ProSitePatterns | PS00351 TFIID; Transcription factor TFIID repeat signature. |
Hamap | MF_00408 |
You might be interested in these researchers

You might be interested in these references
