Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008481552.1 |
sequence |
PEP: >XP_008481552.1 MGKTNSGTKAPRKEGRINRAPHSMNPDRPTEGLKGVAKPRTKATIRRLQMYRCFKAKRDKTGKIIHPAPFQGWVPSGTQS |
Swiss-Prot | Nucleolar GTP-binding protein 2 |
KEGG | K14537 NUG2, GNL2; nuclear GTP-binding protein |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:1.10.1580.10 |
Pfam | PF08153 NGP1NT; NGP1NT (NUC091) domain |
ProSiteProfiles | PS51721 G_CP; Circularly permuted (CP)-type guanine nucleotide-binding (G) domain profile. |
PRINTS | PR00326 |
You might be interested in these researchers

You might be interested in these references
