Gene detail [Fasta]
| Species | Diaphorina citri |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008480693.1 |
| sequence |
PEP: >XP_008480693.1 MVGDDKSTDDVFAGQDTGAQNSQETLLCQHCHEQVLCLEENFLQHSECCTCVSRPNNTYRYVCCFCDFHTEHVTDINAHL |
| Swiss-Prot | Zinc finger and BTB domain-containing protein 48 |
| SUPERFAMILY | SSF57667 beta-beta-alpha zinc fingers superfamily |
| Gene3D | G3DSA:3.30.160.60 |
| Pfam | PF13465 zf-H2C2_2; Zinc-finger double domain |
| SMART | SM00355 |
| ProSiteProfiles | PS50157 ZINC_FINGER_C2H2_2; Zinc finger C2H2 type domain profile. |
| ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
You might be interested in these researchers
You might be interested in these references
