Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008480658.1 |
sequence |
PEP: >XP_008480658.1 MTSIWMRPGLYTVLPVKSAPASSMGDEGSSEVTSSSSAVLVNATVPNLVSPTSSDIGEVDLEFWDLDLNNSHPLATSGDD |
Swiss-Prot | Ecdysone receptor |
KEGG | K14034 |
SUPERFAMILY | SSF57716 Glucocorticoid receptor-like (DNA-binding domain) superfamily |
Gene3D | G3DSA:3.30.50.10 |
Pfam | PF00105 zf-C4; Zinc finger, C4 type (two domains) |
SMART | SM00399 |
ProSiteProfiles | PS51030 NUCLEAR_REC_DBD_2; Nuclear hormone receptors DNA-binding domain profile. |
PRINTS | PR00047 |
ProSitePatterns | PS00031 NUCLEAR_REC_DBD_1; Nuclear hormones receptors DNA-binding region signature. |
You might be interested in these researchers

You might be interested in these references
