Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008479441.1 |
sequence |
PEP: >XP_008479441.1 MLSRLVKSHEEHLPAVLEEIGTNPEQLKKDVASLREWYSYQTHLPQDTKDCVLASFLVGCKNSMEIAKRKLDMFYSERRH |
Swiss-Prot | COBW domain-containing protein 1 |
SUPERFAMILY | SSF90002 Hypothetical protein YjiA, C-terminal domain superfamily |
Gene3D | G3DSA:3.30.1220.10 |
Pfam | PF07683 CobW_C; Cobalamin synthesis protein cobW C-terminal domain |
SMART | SM00833 |
ProSiteProfiles | PS50191 CRAL_TRIO; CRAL-TRIO lipid binding domain profile. |
PRINTS | PR00180 |
You might be interested in these researchers

You might be interested in these references
