Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008479267.1 |
sequence |
PEP: >XP_008479267.1 MPMYNFKKIAVVPTAKEFVDIMLSKTQRKTPTVIHKQYKISRIRSFYMRKIKYTQSNFHERLSQIIQEFPKLDNIHPFYA |
Swiss-Prot | Probable nucleolar GTP-binding protein 1 |
KEGG | K06943 NOG1; nucleolar GTP-binding protein |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF06858 NOG1; Nucleolar GTP-binding protein 1 (NOG1) |
ProSiteProfiles | PS51710 G_OBG; OBG-type guanine nucleotide-binding (G) domain profile. |
PRINTS | PR00326 |
You might be interested in these researchers

You might be interested in these references
