Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008478962.1 |
sequence |
PEP: >XP_008478962.1 MFQIWDWFTGVLGYLGLWTKSGKLLFLGLDNAGKTTLLHMLKDDRLAQPVPTLHPTSEELAIGSEFDNKGGTKARRVWKD |
Swiss-Prot | GTP-binding protein SAR1b |
KEGG | K07953 SAR1; GTP-binding protein SAR1 [EC:3.6.5.-] |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF00025 Arf; ADP-ribosylation factor family |
SMART | SM00177 |
ProSiteProfiles | PS51422 SAR1; small GTPase SAR1 family profile. |
PRINTS | PR00328 |
You might be interested in these researchers

You might be interested in these references
