Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008477495.1 |
sequence |
PEP: >XP_008477495.1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDPSVRSVMHKYLEKKNEVNFDKIFNQVIGYILFKDFCENCCDEPV |
Swiss-Prot | G protein-coupled receptor kinase 1 |
SUPERFAMILY | SSF56112 Protein kinase-like (PK-like) superfamily |
Gene3D | G3DSA:3.30.200.20 |
Pfam | PF00615 RGS; Regulator of G protein signaling domain |
SMART | SM00315 |
ProSiteProfiles | PS50011 PROTEIN_KINASE_DOM; Protein kinase domain profile. |
PRINTS | PR00717 |
ProSitePatterns | PS00107 PROTEIN_KINASE_ATP; Protein kinases ATP-binding region signature. |
You might be interested in these researchers

You might be interested in these references
