Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Diaphorina citri
GenBankhttp://www.ncbi.nlm.nih.gov/protein/XP_008476751.1
sequence PEP:
>XP_008476751.1
MTEWDVDEGIDISHPEPPSTSATKDPSMNAKGPYVYELFSIMIHSGSASGGHYYAYIKNFSTDEWYCFNDQSVTRITDED
IHKSYGGGPARGYYSGVYSSSPLLCKE
Swiss-ProtUbiquitin carboxyl-terminal hydrolase 64E
SUPERFAMILYSSF54001  Cysteine proteinases superfamily     
PfamPF00443  UCH; Ubiquitin carboxyl-terminal hydrolase     
ProSiteProfilesPS50235  USP_3; Ubiquitin specific protease (USP) domain profile.     
ProSitePatternsPS00973  USP_2; Ubiquitin specific protease (USP) domain signature 2.     

You might be interested in these researchers

You might be interested in these references