Gene detail [Fasta]
Species | Zootermopsis nevadensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/KDR11744.1 |
sequence |
PEP: >KDR11744.1 LWWICLMWGWANVASQNHQCPPHHDITPCICTVKKNGLDVLCEFTDQQHISHTMSVLKGSSEVIFYLKLRHNTLPKLQDF |
Swiss-Prot | Leucine-rich repeats and immunoglobulin-like domains protein 2 |
SUPERFAMILY | SSF52058 L domain-like superfamily |
Gene3D | G3DSA:3.80.10.10 |
Pfam | PF13855 LRR_8; Leucine rich repeat |
SMART | SM00365 |
ProSiteProfiles | PS51450 LRR; Leucine-rich repeat profile. |
ProSitePatterns | PS00761 SPASE_I_3; Signal peptidases I signature 3. |
PANTHER | PTHR24373:SF98 |
You might be interested in these researchers

You might be interested in these references
