Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008475715.1 |
sequence |
PEP: >XP_008475715.1 MCSKTKICADCSATDPKWGILNKGVLVCDACCSIHRSLGRHISQVKYLEPSTWPPSLLSMLMTLTNGGAPSLWEHSLCES |
Swiss-Prot | ARF GTPase-activating protein GIT1 |
KEGG | K05737 GIT1; G protein-coupled receptor kinase interactor 1 |
SUPERFAMILY | SSF48403 Ankyrin repeat superfamily |
Gene3D | G3DSA:1.25.40.20 |
Pfam | PF01412 ArfGap; Putative GTPase activating protein for Arf |
SMART | SM00105 |
ProSiteProfiles | PS50115 ARFGAP; ARF GTPase-activating proteins domain profile. |
PRINTS | PR00405 |
You might be interested in these researchers

You might be interested in these references
