Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008475458.1 |
sequence |
PEP: >XP_008475458.1 MILRDADNNELRGSGYFLPKEFDLVAAKVDEIDKEDEGEAKNLPSRTQGSSTPRDVYCTVTLDQEPIYKTCTIERTLNPF |
Swiss-Prot | Ras GTPase-activating protein 3 |
KEGG | K12380 RASA3; Ras GTPase-activating protein 3 |
SUPERFAMILY | SSF50729 PH domain-like superfamily |
Gene3D | G3DSA:1.10.506.10 |
Pfam | PF00616 RasGAP; GTPase-activator protein for Ras-like GTPase |
SMART | SM00107 |
ProSiteProfiles | PS50003 PH_DOMAIN; PH domain profile. |
ProSitePatterns | PS00509 RAS_GTPASE_ACTIV_1; Ras GTPase-activating proteins domain signature. |
You might be interested in these researchers

You might be interested in these references
