Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008475230.1 |
sequence |
PEP: >XP_008475230.1 MFVKCFSEMKPKLGVRLLNPSKYEPLRISVQSFKSWFGGRGDKDNVYGDVADGLKSVYKNKLLPLEEKYLFHEFHSPKLT |
Swiss-Prot | EH domain-containing protein 1 |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF12763 EF-hand_4; Cytoskeletal-regulatory complex EF hand |
SMART | SM00027 |
ProSiteProfiles | PS50222 EF_HAND_2; EF-hand calcium-binding domain profile. |
ProSitePatterns | PS00018 EF_HAND_1; EF-hand calcium-binding domain. |
You might be interested in these researchers

You might be interested in these references
