Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008474893.1 |
sequence |
PEP: >XP_008474893.1 MDIWNSDEVEKNINPEDKPEDEFDEDDDAFLPPDEPPGKVEETLPGSGVEVKGEDQQEEPEAEEAKDLERPEDDRDLLSE |
Swiss-Prot | FERM, RhoGEF and pleckstrin domain-containing protein 2 |
KEGG | K06082 FARP2, FRG; FERM, RhoGEF and pleckstrin domain protein 2 |
SUPERFAMILY | SSF48065 DBL homology domain (DH-domain) superfamily |
Gene3D | G3DSA:1.20.900.10 |
Pfam | PF00621 RhoGEF; RhoGEF domain |
SMART | SM00233 |
ProSiteProfiles | PS50010 DH_2; Dbl homology (DH) domain profile. |
You might be interested in these researchers

You might be interested in these references
