Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008474643.1 |
sequence |
PEP: >XP_008474643.1 MMETEKFMETDKCKLPPMTILYDPNRKKEPAPQFASEKEMCFKYFDKWSEQDQIDFVENLLSRMCHYQHGHINTYLKPML |
Swiss-Prot | F-box/WD repeat-containing protein 1A |
KEGG | K03362 FBXW1_11, BTRC, beta-TRCP; F-box and WD-40 domain protein 1/11 |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:2.130.10.10 |
Pfam | PF00400 WD40; WD domain, G-beta repeat |
SMART | SM01028 |
ProSiteProfiles | PS50294 WD_REPEATS_REGION; Trp-Asp (WD) repeats circular profile. |
PRINTS | PR00320 |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
You might be interested in these researchers

You might be interested in these references
