Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008474032.1 |
sequence |
PEP: >XP_008474032.1 MLTDQEKVRVVSGFILHSPPGEFNEVFNDVRGLLNNDVLLKDDVSKAFVQYNKEQLTPVKLNNSDLPVLISEHNDLGNGR |
Swiss-Prot | F-actin-capping protein subunit alpha |
KEGG | K10364 |
SUPERFAMILY | SSF90096 Subunits of heterodimeric actin filament capping protein Capz superfamily |
Pfam | PF01267 F-actin_cap_A; F-actin capping protein alpha subunit |
PRINTS | PR00191 |
ProSitePatterns | PS00749 F_ACTIN_CAPPING_A_2; F-actin capping protein alpha subunit signature 2. |
You might be interested in these researchers

You might be interested in these references
