Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008471937.1 |
sequence |
PEP: >XP_008471937.1 MFGNQEENATATNQDVEMNDADDEDRARSEVRFSFKVENIHNLKDTALSPPHYARNLPWKIMVMPTTRYLGFFLQCNGET |
Swiss-Prot | Ubiquitin carboxyl-terminal hydrolase 7 |
KEGG | K11838 USP7, UBP15; ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12] |
SUPERFAMILY | SSF54001 Cysteine proteinases superfamily |
Gene3D | G3DSA:2.20.210.10 |
Pfam | PF14533 USP7_C2; Ubiquitin-specific protease C-terminal |
SMART | SM00061 |
ProSiteProfiles | PS50235 USP_3; Ubiquitin specific protease (USP) domain profile. |
Coils | Coil |
ProSitePatterns | PS00973 USP_2; Ubiquitin specific protease (USP) domain signature 2. |
You might be interested in these researchers

You might be interested in these references
