Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008470742.1 |
sequence |
PEP: >XP_008470742.1 MDPSVLAAMDKDALKKQIENMKYQATMERWPLSKSIQAMREYVEENEKNDPLIHAPDKKNNPWAEKGKCSIM |
Swiss-Prot | Guanine nucleotide-binding protein subunit gamma-e |
KEGG | K04547 GNG13; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 |
SUPERFAMILY | SSF48670 Transducin (heterotrimeric G protein), gamma chain superfamily |
Gene3D | G3DSA:4.10.260.10 |
Pfam | PF00631 G-gamma; GGL domain |
SMART | SM00224 |
ProSiteProfiles | PS50058 G_PROTEIN_GAMMA; G-protein gamma subunit domain profile. |
PRINTS | PR00321 |
You might be interested in these researchers

You might be interested in these references
