Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008470473.1 |
sequence |
PEP: >XP_008470473.1 MEQRHFIQASLEYVFRIQEVQERKKFEFVEILLGFMFGWLTFYHQAYEVAEDFKPYMRELQFRIQKTRENFNATRDKTES |
Swiss-Prot | Rho GTPase-activating protein 10 |
KEGG | K13736 ARHGAP10; Rho GTPase-activating protein 10 |
SUPERFAMILY | SSF48350 GTPase activation domain, GAP superfamily |
Gene3D | G3DSA:1.10.555.10 |
Pfam | PF00620 RhoGAP; RhoGAP domain |
SMART | SM00324 |
ProSiteProfiles | PS50003 PH_DOMAIN; PH domain profile. |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
