Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008470343.1 |
sequence |
PEP: >XP_008470343.1 MLEVILRIKNFNVYTVHDTHDECVCQYCHEHLPKDRVALMTHAKLCVMVSRPVKSYRFVCYTCSYHTQFSNRFSDHIKHH |
Swiss-Prot | Longitudinals lacking protein, isoforms A/B/D/L |
SUPERFAMILY | SSF57667 beta-beta-alpha zinc fingers superfamily |
Gene3D | G3DSA:3.30.160.60 |
Pfam | PF00096 zf-C2H2; Zinc finger, C2H2 type |
SMART | SM00355 |
ProSiteProfiles | PS50157 ZINC_FINGER_C2H2_2; Zinc finger C2H2 type domain profile. |
ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
You might be interested in these researchers

You might be interested in these references
