Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008469450.1 |
sequence |
PEP: >XP_008469450.1 MQICEESSSSSGMDLIDDIKIEEVSVDDEGEYSDSVFDDSSFMTEAQRRMIFTQIYIPKDGGMHSILASSGEVNHKNRPG |
Swiss-Prot | X-box-binding protein 1 |
KEGG | K09027 XBP1; X box-binding protein 1 |
SUPERFAMILY | SSF57959 Leucine zipper domain superfamily |
Gene3D | G3DSA:1.20.5.170 |
Pfam | PF00170 bZIP_1; bZIP transcription factor |
SMART | SM00338 |
ProSiteProfiles | PS50217 BZIP; Basic-leucine zipper (bZIP) domain profile. |
Coils | Coil |
ProSitePatterns | PS00036 BZIP_BASIC; Basic-leucine zipper (bZIP) domain signature. |
You might be interested in these researchers

You might be interested in these references
