Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008469004.1 |
sequence |
PEP: >XP_008469004.1 MLRQTLLATRKIVTSPILQGPIELPKLDYGYKDLEPVINSEIMELHHSKHHQTYVTNYNAALEKLKAAVANNDASAIVQL |
Swiss-Prot | Superoxide dismutase [Mn] 1, mitochondrial |
KEGG | K04564 SOD2; superoxide dismutase, Fe-Mn family [EC:1.15.1.1] |
SUPERFAMILY | SSF46609 Fe,Mn superoxide dismutase (SOD), N-terminal domain superfamily |
Gene3D | G3DSA:1.10.287.990 |
Pfam | PF00081 Sod_Fe_N; Iron/manganese superoxide dismutases, alpha-hairpin domain |
PRINTS | PR01703 |
ProSitePatterns | PS00088 SOD_MN; Manganese and iron superoxide dismutases signature. |
PIRSF | PIRSF000349 |
You might be interested in these researchers

You might be interested in these references
