Gene detail [Fasta]
Species | Diaphorina citri |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008468474.1 |
sequence |
PEP: >XP_008468474.1 SRDIKEVTESKHCFNKVSAELDLALQKHSAASKTKPLEIEDARNLLTATRKCFRHTALDHLHNVTLMHTKKRHLLLSTLL |
Swiss-Prot | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 |
KEGG | K12489 ACAP; Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein |
SUPERFAMILY | SSF50729 PH domain-like superfamily |
Gene3D | G3DSA:1.20.1270.60 |
Pfam | PF00169 PH; PH domain |
SMART | SM00233 |
ProSiteProfiles | PS50115 ARFGAP; ARF GTPase-activating proteins domain profile. |
PRINTS | PR00405 |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
