Gene detail [Fasta]
| Species | Microplitis demolitor |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008559402.1 |
| sequence |
PEP: >XP_008559402.1 MACCLSEEAKEQKRINQEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMA |
| Swiss-Prot | Guanine nucleotide-binding protein G(q) subunit alpha |
| KEGG | K04634 GNAQ; guanine nucleotide-binding protein G(q) subunit alpha |
| SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
| Gene3D | G3DSA:1.10.400.10 |
| Pfam | PF00503 G-alpha; G-protein alpha subunit |
| SMART | SM00275 |
| PRINTS | PR00318 |
| Coils | Coil |
| PANTHER | PTHR10218:SF81 |
You might be interested in these researchers
You might be interested in these references
