Gene detail [Fasta]
| Species | Zootermopsis nevadensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/KDR11459.1 |
| sequence |
PEP: >KDR11459.1 MAAVKTFLAGEPFHLFENSMYFHRYLQWKWLESQPVTYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKR |
| Swiss-Prot | G protein-coupled receptor kinase 2 |
| KEGG | K08291 GRK4_5_6; G protein-coupled receptor kinase [EC:2.7.11.16] |
| SUPERFAMILY | SSF56112 Protein kinase-like (PK-like) superfamily |
| Gene3D | G3DSA:1.10.510.10 |
| Pfam | PF00069 Pkinase; Protein kinase domain |
| SMART | SM00133 |
| ProSiteProfiles | PS50011 PROTEIN_KINASE_DOM; Protein kinase domain profile. |
| PRINTS | PR00717 |
| ProSitePatterns | PS00107 PROTEIN_KINASE_ATP; Protein kinases ATP-binding region signature. |
| PANTHER | PTHR24355:SF24 |
You might be interested in these researchers
You might be interested in these references
