Gene detail [Fasta]
| Species | Microplitis demolitor |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008549792.1 |
| sequence |
PEP: >XP_008549792.1 MSGGLAPSKSTVYISNLPFSLTNNDIYQLLESHGKIVKVTVVKDKTTRRSKGVAFVLFLTREDAKNCAKNLNNTQIGGRT |
| Swiss-Prot | Zinc finger CCHC-type and RNA-binding motif-containing protein 1 |
| KEGG | K13154 |
| SUPERFAMILY | SSF54928 RNA-binding domain, RBD superfamily |
| Gene3D | G3DSA:3.30.70.330 |
| Pfam | PF00098 zf-CCHC; Zinc knuckle |
| SMART | SM00360 |
| ProSiteProfiles | PS50158 ZF_CCHC; Zinc finger CCHC-type profile. |
| Coils | Coil |
| PANTHER | PTHR23139 |
You might be interested in these researchers
You might be interested in these references
