Gene detail [Fasta]
Species | Microplitis demolitor |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_008547836.1 |
sequence |
PEP: >XP_008547836.1 MSLADGGGLSRYEIFSIVARLTLVTAVGFFSMRWFISQIDPMAKTKRKAKEKAKEQLKKLAKTSGVSLSIDTNQLTEYEM |
Swiss-Prot | ATPase family AAA domain-containing protein 1 |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF00004 AAA; ATPase family associated with various cellular activities (AAA) |
SMART | SM00382 |
Coils | Coil |
ProSitePatterns | PS00674 AAA; AAA-protein family signature. |
PANTHER | PTHR23074:SF20 |
You might be interested in these researchers

You might be interested in these references
