Gene detail [Fasta]
| Species | Athalia rosae |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012251917.1 |
| sequence |
PEP: >XP_012251917.1 MTSAKIEFSVEMSCDKCVQAVKSSLSNVDGIENIDVSLDNGTVIVNTTLPYSLIQEKIENSGRRAVLKGYGGTEVSAVAM |
| Swiss-Prot | Copper chaperone for superoxide dismutase |
| KEGG | K04569 CCS; copper chaperone for superoxide dismutase |
| SUPERFAMILY | SSF55008 HMA, heavy metal-associated domain superfamily |
| Gene3D | G3DSA:3.30.70.100 |
| Pfam | PF00080 Sod_Cu; Copper/zinc superoxide dismutase (SODC) |
| ProSiteProfiles | PS50846 HMA_2; Heavy-metal-associated domain profile. |
| PRINTS | PR00068 |
You might be interested in these researchers
You might be interested in these references
