Gene detail [Fasta]
| Species | Wasmannia auropunctata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011707708.1 |
| sequence |
PEP: >XP_011707708.1 MDGKVDDENQRGVNDGDWVCPDSQCANINFARRNSCNRCGKDRGECPKKKKLGQEIGKAAAEKSRGLFSADDWQCSKCGN |
| Swiss-Prot | Zinc finger Ran-binding domain-containing protein 2 |
| SUPERFAMILY | SSF90209 Ran binding protein zinc finger-like superfamily |
| Gene3D | G3DSA:4.10.1060.10 |
| Pfam | PF00641 zf-RanBP; Zn-finger in Ran binding protein and others |
| SMART | SM00547 |
| ProSiteProfiles | PS50199 ZF_RANBP2_2; Zinc finger RanBP2 type profile. |
| Coils | Coil |
| ProSitePatterns | PS01358 ZF_RANBP2_1; Zinc finger RanBP2-type signature. |
| PIRSF | PIRSF037956 |
You might be interested in these researchers
You might be interested in these references
