Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011707178.1 |
sequence |
PEP: >XP_011707178.1 PQACGRPEQPPNSTMVVTSASAKTPGVSPVYEVGATVEYSCNVGSLLIGPSTRTCLDTGFYNEFPPACKNIECGYPASIT |
Swiss-Prot | Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 |
SUPERFAMILY | SSF57535 Complement control module/SCR domain superfamily |
Gene3D | G3DSA:2.10.70.10 |
Pfam | PF00084 Sushi; Sushi repeat (SCR repeat) |
SMART | SM00032 |
ProSiteProfiles | PS50923 SUSHI; Sushi/CCP/SCR domain profile. |
You might be interested in these researchers

You might be interested in these references
