Gene detail [Fasta]
| Species | Wasmannia auropunctata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011706174.1 |
| sequence |
PEP: >XP_011706174.1 MTMTTYDKVKTIGDTTFFDIQLDAYREEIYTREEICDNILTMIITGSDTISTTINFVIFVLANFPDIQEKAYKELLEIYG |
| Swiss-Prot | Cytochrome P450 4c21 |
| KEGG | K17961 CYP82G1; cytochrome P450, family 82, subfamily G, polypeptide 1 [EC:1.14.-.-] |
| SUPERFAMILY | SSF48264 Cytochrome P450 superfamily |
| Gene3D | G3DSA:1.10.630.10 |
| Pfam | PF00067 p450; Cytochrome P450 |
| PRINTS | PR00463 |
| ProSitePatterns | PS00086 CYTOCHROME_P450; Cytochrome P450 cysteine heme-iron ligand signature. |
You might be interested in these researchers
You might be interested in these references
