Gene detail [Fasta]
| Species | Wasmannia auropunctata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011704994.1 |
| sequence |
PEP: >XP_011704994.1 MASLNVFKCVLLLLFVLSQTGHGYNEDVLQYTHDNFSAEVGKKNHFVMFYAPWCGHCQRLGPTWEQLAIVMEISTEEDNI |
| Swiss-Prot | Thioredoxin domain-containing protein 5 |
| KEGG | K13984 TXNDC5, ERP46; thioredoxin domain-containing protein 5 |
| SUPERFAMILY | SSF52833 Thioredoxin-like superfamily |
| Gene3D | G3DSA:3.40.30.10 |
| Pfam | PF00085 Thioredoxin; Thioredoxin |
| ProSiteProfiles | PS51352 THIOREDOXIN_2; Thioredoxin domain profile. |
| PRINTS | PR00421 |
| ProSitePatterns | PS00194 THIOREDOXIN_1; Thioredoxin family active site. |
| TIGRFAM | TIGR01126 |
You might be interested in these researchers
You might be interested in these references
