Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011704571.1 |
sequence |
PEP: >XP_011704571.1 MILCPYYRAPSIISSRVPREERNRKPRENGMHPFGFLDDGITGCTGTETGEIPMAPKNKENNSKRKKQMEDEGDEDYRKR |
Swiss-Prot | CCAAT/enhancer-binding protein gamma |
KEGG | K10049 CEBPG; CCAAT/enhancer binding protein (C/EBP), gamma |
SUPERFAMILY | SSF57959 Leucine zipper domain superfamily |
Gene3D | G3DSA:1.20.5.170 |
Pfam | PF07716 bZIP_2; Basic region leucine zipper |
SMART | SM00338 |
ProSiteProfiles | PS50217 BZIP; Basic-leucine zipper (bZIP) domain profile. |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
