Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011702828.1 |
sequence |
PEP: >XP_011702828.1 MPVYYTGLNASPLFSNQDGIVTSISNLTQISFPGITDIEIGWNYFLLWQDTKLYITGKISEDDDKNRPRLTQIPEESSGS |
Swiss-Prot | RCC1 domain-containing protein 1 |
SUPERFAMILY | SSF50985 RCC1/BLIP-II superfamily |
Gene3D | G3DSA:2.130.10.30 |
Pfam | PF00415 RCC1; Regulator of chromosome condensation (RCC1) repeat |
ProSiteProfiles | PS50012 RCC1_3; Regulator of chromosome condensation (RCC1) repeat profile. |
PRINTS | PR00633 |
ProSitePatterns | PS00626 RCC1_2; Regulator of chromosome condensation (RCC1) signature 2. |
You might be interested in these researchers

You might be interested in these references
