Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011702568.1 |
sequence |
PEP: >XP_011702568.1 MCTRNNMAPATVDLTDFQKEIFEKISKNEVCELKTLLAQNKVKMDFVDENGMSPLQHACYKGNKEIVQLLLDQGADVNAC |
Swiss-Prot | Ankyrin repeat and MYND domain-containing protein 2 |
SUPERFAMILY | SSF144232 HIT/MYND zinc finger-like superfamily |
Gene3D | G3DSA:1.25.40.20 |
Pfam | PF01753 zf-MYND; MYND finger |
SMART | SM00248 |
ProSiteProfiles | PS50865 ZF_MYND_2; Zinc finger MYND-type profile. |
ProSitePatterns | PS01360 ZF_MYND_1; Zinc finger MYND-type signature. |
You might be interested in these researchers

You might be interested in these references
