Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011699890.1 |
sequence |
PEP: >XP_011699890.1 MTAIGDVQALQTLTVYTSDVNSVDFAGDCILVTGSGDKHVRVWEWQPGTGYVEAYFSPLMGHKYGVTSVKVSPQSTMLAT |
Swiss-Prot | WD repeat, SAM and U-box domain-containing protein 1 |
SUPERFAMILY | SSF57850 RING/U-box superfamily |
Gene3D | G3DSA:3.30.40.10 |
Pfam | PF04564 U-box; U-box domain |
SMART | SM00504 |
ProSiteProfiles | PS50294 WD_REPEATS_REGION; Trp-Asp (WD) repeats circular profile. |
PRINTS | PR00320 |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
You might be interested in these researchers

You might be interested in these references
