Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011699547.1 |
sequence |
PEP: >XP_011699547.1 MRVAALAVGEEGEEEEEEDEEEEAECRAGHHHGARGPAMRSAAAATVGGRSQWSITTCPIFFVLLLLSVWNLMTVVDASP |
Swiss-Prot | Disintegrin and metalloproteinase domain-containing protein 10 |
KEGG | K06704 ADAM10; disintegrin and metalloproteinase domain-containing protein 10 [EC:3.4.24.81] |
SUPERFAMILY | SSF57552 Blood coagulation inhibitor (disintegrin) superfamily |
Gene3D | G3DSA:4.10.70.10 |
Pfam | PF13688 Reprolysin_5; Metallo-peptidase family M12 |
SMART | SM00050 |
ProSiteProfiles | PS50214 DISINTEGRIN_2; Disintegrin domain profile. |
You might be interested in these researchers

You might be interested in these references
