Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011697622.1 |
sequence |
PEP: >XP_011697622.1 MQSVSTEGASPGGRRLSRSFHSCLRGADQDDLESDTSYEKACRRGSAPATPVLGARPLDVTPNRIVNFFSKRSFRSNPLK |
Swiss-Prot | Disabled homolog 2-interacting protein |
SUPERFAMILY | SSF49562 C2 domain (Calcium/lipid-binding domain, CaLB) superfamily |
Gene3D | G3DSA:2.60.40.150 |
Pfam | PF12004 DUF3498; Domain of unknown function (DUF3498) |
SMART | SM00323 |
ProSiteProfiles | PS50018 RAS_GTPASE_ACTIV_2; Ras GTPase-activating proteins profile. |
Coils | Coil |
ProSitePatterns | PS00509 RAS_GTPASE_ACTIV_1; Ras GTPase-activating proteins domain signature. |
You might be interested in these researchers

You might be interested in these references
