Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011697619.1 |
sequence |
PEP: >XP_011697619.1 MKLEYPCRVEGWLNVCEAECCVGEAASEACWEPCYCVLLQDEQTLTAYRSEDMALGDAMFVELPRVRLDGGARAFRQHWG |
Swiss-Prot | Probable Ras GTPase-activating protein |
KEGG | K17633 RASAL2; RAS protein activator-like 2 |
SUPERFAMILY | SSF50729 PH domain-like superfamily |
Gene3D | G3DSA:2.30.29.30 |
Pfam | PF00616 RasGAP; GTPase-activator protein for Ras-like GTPase |
SMART | SM00323 |
ProSiteProfiles | PS50018 RAS_GTPASE_ACTIV_2; Ras GTPase-activating proteins profile. |
Coils | Coil |
ProSitePatterns | PS00509 RAS_GTPASE_ACTIV_1; Ras GTPase-activating proteins domain signature. |
You might be interested in these researchers

You might be interested in these references
