Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011697493.1 |
sequence |
PEP: >XP_011697493.1 MGACLEVPSTPCDNNRKCSPRSTSRPSPRPPPTSPTDVAVNHEASSSPTRFGRVNPIKLELMELENIVANTVYLKAREGG |
Swiss-Prot | G protein-coupled receptor kinase 5 |
KEGG | K08291 GRK4_5_6; G protein-coupled receptor kinase [EC:2.7.11.16] |
SUPERFAMILY | SSF48097 Regulator of G-protein signaling, RGS superfamily |
Gene3D | G3DSA:3.30.200.20 |
Pfam | PF00069 Pkinase; Protein kinase domain |
SMART | SM00315 |
ProSiteProfiles | PS51285 AGC_KINASE_CTER; AGC-kinase C-terminal domain profile. |
PRINTS | PR00717 |
ProSitePatterns | PS00107 PROTEIN_KINASE_ATP; Protein kinases ATP-binding region signature. |
You might be interested in these researchers

You might be interested in these references
