Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011696660.1 |
sequence |
PEP: >XP_011696660.1 MYDFYSETPACFSARLTARQGVRPACRPDGTYAPVQCHAETEYCWCVTPQGRPLPDTTVRYKKPRCLRAGSRPAAASTRS |
Swiss-Prot | SPARC-related modular calcium-binding protein 2 |
SUPERFAMILY | SSF57610 Thyroglobulin type-1 domain superfamily |
Gene3D | G3DSA:1.10.238.10 |
Pfam | PF10591 SPARC_Ca_bdg; Secreted protein acidic and rich in cysteine Ca binding region |
SMART | SM00211 |
ProSiteProfiles | PS51162 THYROGLOBULIN_1_2; Thyroglobulin type-1 domain profile. |
ProSitePatterns | PS00484 THYROGLOBULIN_1_1; Thyroglobulin type-1 repeat signature. |
You might be interested in these researchers

You might be interested in these references
