Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Wasmannia auropunctata
GenBankhttp://www.ncbi.nlm.nih.gov/protein/XP_011696229.1
sequence PEP:
>XP_011696229.1
MILCYMPQCKNRSDSQNLKQQNIPKVTFHRNGTTRNLWIDILGLDQTSIPSSARICSDHFKEEFFDR
Swiss-ProtC-terminal-binding protein 1
SUPERFAMILYSSF57716  Glucocorticoid receptor-like (DNA-binding domain) superfamily     
PfamPF05485  THAP; THAP domain     
ProSiteProfilesPS50950  ZF_THAP; Zinc finger THAP-type profile     

You might be interested in these researchers

You might be interested in these references