Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011695322.1 |
sequence |
PEP: >XP_011695322.1 MVTKASKQTARGFRTLWIRFDADSSDKHQLFFKEHSVRNQEPEYPRNKTLFVLNVPPYATTDCLKHAFDNLCGQVRSVTF |
Swiss-Prot | Ribosomal RNA-processing protein 7 homolog A |
KEGG | K14545 RRP7; ribosomal RNA-processing protein 7 |
SUPERFAMILY | SSF54928 RNA-binding domain, RBD superfamily |
Gene3D | G3DSA:3.30.70.330 |
Pfam | PF12923 RRP7; Ribosomal RNA-processing protein 7 (RRP7) |
ProSiteProfiles | PS50102 RRM; Eukaryotic RNA Recognition Motif (RRM) profile. |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
