Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011694911.1 |
sequence |
PEP: >XP_011694911.1 MFRISPPVLCPFFPTVFFVVFFLSHHRKLRVNSVQTAQREWQRDPEPKLREALRTAAERAIAEQPENEELKYILRSTAER |
Swiss-Prot | Uncharacterized WD repeat-containing protein alr3466 |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF13191 AAA_16; AAA ATPase domain |
SMART | SM00320 |
ProSiteProfiles | PS50294 WD_REPEATS_REGION; Trp-Asp (WD) repeats circular profile. |
PRINTS | PR00320 |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
You might be interested in these researchers

You might be interested in these references
