Gene detail [Fasta]
| Species | Zootermopsis nevadensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/KDQ94595.1 |
| sequence |
PEP: >KDQ94595.1 MEITTEHSIPLDILDDLGSRFIINVPVEERKDLVRICFQIELAHWYYIDFYCADDKVEKKLKPCGMKEFTAHMFQHIPFL |
| Swiss-Prot | m7GpppN-mRNA hydrolase |
| KEGG | K12613 DCP2; mRNA-decapping enzyme subunit 2 [EC:3.6.1.62] |
| SUPERFAMILY | SSF140586 Dcp2 domain-like superfamily |
| Gene3D | G3DSA:3.90.79.10 |
| Pfam | PF05026 DCP2; Dcp2, box A domain |
| ProSiteProfiles | PS51462 NUDIX; Nudix hydrolase domain profile. |
| ProSitePatterns | PS00893 NUDIX_BOX; Nudix box signature. |
| PANTHER | PTHR23114 |
You might be interested in these researchers
You might be interested in these references
